PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Jcr4S10413.10
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Jatropheae; Jatropha
Family Whirly
Protein Properties Length: 143aa    MW: 16506.4 Da    PI: 9.1316
Description Whirly family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Jcr4S10413.10genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Whirly55.31.4e-172776453
         Whirly  4 ktkaalkvkavrptfealdsgnlklkraGglllelanataerkydWekkq 53
                   k k+al+v +v+ptf++ldsg+l+++r+G+l+l++++a++erkyd++++q
  Jcr4S10413.10 27 KEKTALSVSPVLPTFTKLDSGHLTVQRRGSLMLTFMPAIGERKYDYSRRQ 76
                   88********************************************9987 PP

2Whirly36.87.3e-121091375482
         Whirly  54 sfalsatevaelvdlaskesceffhdpaa 82 
                     falsatev++l++l++k+s+effhdp++
  Jcr4S10413.10 109 CFALSATEVGSLISLGPKDSSEFFHDPSM 137
                    69*************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF085365.6E-162776IPR013742Plant transcription factor
SuperFamilySSF544476.04E-142776IPR009044ssDNA-binding transcriptional regulator
Gene3DG3DSA:2.30.31.102.7E-172776IPR009044ssDNA-binding transcriptional regulator
SuperFamilySSF544477.3E-7105137IPR009044ssDNA-binding transcriptional regulator
PfamPF085368.7E-9109139IPR013742Plant transcription factor
Gene3DG3DSA:2.30.31.101.7E-8109139IPR009044ssDNA-binding transcriptional regulator
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 143 aa     Download sequence    Send to blast
MGEMLQGCML FHSRLAFQLL EFILLKKEKT ALSVSPVLPT FTKLDSGHLT VQRRGSLMLT  60
FMPAIGERKY DYSRRQGRIS FLFTYNLNLF INQVLPWLQF HYYPPEMLCF ALSATEVGSL  120
ISLGPKDSSE FFHDPSMLSR LIF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4kop_A4e-32271391999Single-stranded DNA-binding protein WHY2, mit
4kop_B4e-32271391999Single-stranded DNA-binding protein WHY2, mit
4kop_C4e-32271391999Single-stranded DNA-binding protein WHY2, mit
4kop_D4e-32271391999Single-stranded DNA-binding protein WHY2, mit
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012079715.11e-42PREDICTED: single-stranded DNA-bindig protein WHY2, mitochondrial
SwissprotQ8VYF73e-32WHY2_ARATH; Single-stranded DNA-binding protein WHY2, mitochondrial
TrEMBLA0A067KIF31e-42A0A067KIF3_JATCU; Uncharacterized protein
STRINGPOPTR_0003s04700.12e-32(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF113833338
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G71260.12e-33WHIRLY 2